Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate AZOBR_RS06415 AZOBR_RS06415 anthranilate synthase subunit I
Query= SwissProt::P26922 (196 letters) >FitnessBrowser__azobra:AZOBR_RS06415 Length = 737 Score = 136 bits (343), Expect = 8e-37 Identities = 83/195 (42%), Positives = 105/195 (53%), Gaps = 2/195 (1%) Query: 2 LLLIDNYDSFTYNLVHYLGELGAELDVRRNDSLTVEEAMALRPEGIVLSPGPCDPDKAGI 61 +LL+D+ DSF + L YL + GA + R+ A RP+ +VLSPGP P + Sbjct: 539 VLLVDHDDSFVHTLADYLRQTGASVMTLRHGHARAALAER-RPDLVVLSPGPGRPADFNV 597 Query: 62 CLPLIDAAAKAAVPLMGVCLGHQAIGQPFGGTVVRAPVPMHGKVDRMFHQGRGVLKDLPS 121 IDAA +P+ GVCLG Q + + FGG + P P+HGK + G + LP Sbjct: 598 A-GTIDAALALGLPVFGVCLGLQGMVERFGGALDVLPEPVHGKATEVRVLGGALFAGLPE 656 Query: 122 PFRATRYHSLIVERATLPACLEVTGETEDGLIMALSHRELPIHGVQFHPESIESEHGHKI 181 R RYHSL+ R LPA L VT ET DGL+MA+ HR LP+ VQFHPESI S G Sbjct: 657 RMRVGRYHSLVARRDRLPADLTVTAETADGLVMAVEHRRLPLAAVQFHPESILSLDGGAG 716 Query: 182 LENFLNTTRRLETAA 196 L N RL A Sbjct: 717 LALLGNVMDRLAAGA 731 Lambda K H 0.321 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 737 Length adjustment: 30 Effective length of query: 166 Effective length of database: 707 Effective search space: 117362 Effective search space used: 117362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS06415 AZOBR_RS06415 (anthranilate synthase subunit I)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.3285.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.3285.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.