Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate Echvi_2206 Echvi_2206 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
Query= metacyc::MONOMER-13957 (96 letters) >FitnessBrowser__Cola:Echvi_2206 Length = 95 Score = 75.9 bits (185), Expect = 1e-19 Identities = 38/94 (40%), Positives = 52/94 (55%) Query: 3 RISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNV 62 +I I +K +AHLARL E AK T + I+ + E L +V+T+ V P T + NV Sbjct: 2 KIDINTLKKIAHLARLEFDENSAKKMTRDMTQILDWVEHLEQVDTEGVAPITTMSSEVNV 61 Query: 63 MREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD 96 +RED G L E +KNAP Y RVP +L+ Sbjct: 62 LREDAVGSHLSHEKGLKNAPQKDSDYFRVPKVLE 95 Lambda K H 0.312 0.130 0.349 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 40 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 95 Length adjustment: 10 Effective length of query: 86 Effective length of database: 85 Effective search space: 7310 Effective search space used: 7310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 39 (19.6 bits)
Align candidate Echvi_2206 Echvi_2206 (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.8511.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.8511.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.