Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate Echvi_2514 Echvi_2514 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
Query= CharProtDB::CH_024511 (196 letters) >FitnessBrowser__Cola:Echvi_2514 Length = 194 Score = 144 bits (363), Expect = 1e-39 Identities = 83/197 (42%), Positives = 116/197 (58%), Gaps = 4/197 (2%) Query: 1 MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRER 60 M+V I+ N+ SV A+ R G ++ D + + ADK+ PG G A +AM +RER Sbjct: 1 MDVAIIKYNSGNVLSVLYALERLGINANLTDDVEEIKKADKVIFPGQGEASSAMRYLRER 60 Query: 61 ELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNR 120 L LIK QP GICLG QLL SEE N + LG+ V K +PH+GWN Sbjct: 61 NLDQLIKDLKQPFFGICLGQQLLCEYSEE-NDTECLGVFPVKVRKFPPAD-KVPHVGWNS 118 Query: 121 VYPQAGNRLFQGIEDGAYFYFVHSYAMPVNP-WTIAQCNYGEPFTAAVQKDNFYGVQFHP 179 + G +L +GI Y Y+VHSY ++P +T+A+ +Y E F+A +QKDNFY +Q HP Sbjct: 119 LQETQG-QLLEGINTHDYVYYVHSYFAEIHPEFTVAKTHYIEDFSALLQKDNFYAMQAHP 177 Query: 180 ERSGAAGAKLLKNFLEM 196 E+S +G K+L NFL++ Sbjct: 178 EKSSHSGQKILTNFLKL 194 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 194 Length adjustment: 20 Effective length of query: 176 Effective length of database: 174 Effective search space: 30624 Effective search space used: 30624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
Align candidate Echvi_2514 Echvi_2514 (imidazole glycerol phosphate synthase, glutamine amidotransferase subunit)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.10827.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10827.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.