Align Acetolactate synthase small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase small subunit; AHAS; ALS (uncharacterized)
to candidate Echvi_2057 Echvi_2057 acetolactate synthase, small subunit
Query= curated2:A0QUX7 (170 letters) >FitnessBrowser__Cola:Echvi_2057 Length = 167 Score = 95.9 bits (237), Expect = 3e-25 Identities = 52/154 (33%), Positives = 93/154 (60%), Gaps = 1/154 (0%) Query: 8 HTLSVLVEDKPGVLARVSSLFSRRGFNIQSLAVGATEQKDMSRMTIVVSVEDSPLEQITK 67 +T+S+ E+ G+L RV+ +F+RRG NI +L +++ + R+TI V+ + + QI K Sbjct: 4 YTVSLFTENFIGILNRVTLIFTRRGVNIDALTASESKEDGVHRITIEVTTTEDQVIQIVK 63 Query: 68 QLNKLINVIKIVEQEEDNSVSRELALIKVRADATTRGQIIEAVNLFRAKVVDVSTESLTI 127 Q K+I+VIK ++D V +E+AL K+ + G + + + + A+++ E + I Sbjct: 64 QTEKIIDVIKSFYYKDDEVVYQEIALYKIPISSLDPG-LEKVIRQYNARIISAEKEFVVI 122 Query: 128 EATGTPEKLEALLRVLEPYGIREIAQSGVVSVSR 161 E TG E +ALL +L+ + I E A+SG V+V++ Sbjct: 123 EMTGHKEDTKALLEILKDFNILEFARSGRVAVAK 156 Lambda K H 0.313 0.130 0.334 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 73 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 167 Length adjustment: 18 Effective length of query: 152 Effective length of database: 149 Effective search space: 22648 Effective search space used: 22648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 43 (21.2 bits)
Align candidate Echvi_2057 Echvi_2057 (acetolactate synthase, small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.3084.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.3084.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.