PaperBLAST – Find papers about a protein or its homologs

 

Align NP_009746.1 to PF01169 (UPF0016)

NP_009746.1 has 280 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-44  136.6  23.7    2.1e-24   72.0   5.6    2.3  2  NP_009746.1  


Domain annotation for each sequence (and alignments):
>> NP_009746.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.4  10.1   6.4e-24   6.4e-24       2      75 .]      44     117 ..      43     117 .. 0.98
   2 !   72.0   5.6   2.1e-24   2.1e-24       2      75 .]     195     268 ..     194     268 .. 0.98

  Alignments for each domain:
  == domain 1  score: 70.4 bits;  conditional E-value: 6.4e-24
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  +++++i l+E+GDkT+l+aal+a+r+k + Vf +a+  la+mt+ls ++G+s   +l+er++ ++a++lFl+fG
  NP_009746.1  44 MSVSMIGLSEIGDKTFLIAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFG 117
                  799***********************9999*******************************************9 PP

  == domain 2  score: 72.0 bits;  conditional E-value: 2.1e-24
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  + fl++fl ElGD++q+ ++++a+ ++++ V++Gav+++a++++l+v+ G+ la+r++ r+i+l++ +lF++f+
  NP_009746.1 195 QIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLAVVGGKLLATRISIRTITLASSLLFFIFA 268
                  78***********************************************************************7 PP



Or compare NP_009746.1 to CDD or PaperBLAST