PaperBLAST – Find papers about a protein or its homologs

 

Align NP_035756.2 to PF01169 (UPF0016)

NP_035756.2 has 323 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.8e-49  150.1  19.9    1.6e-26   78.8   3.1    2.2  2  NP_035756.2  


Domain annotation for each sequence (and alignments):
>> NP_035756.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.1   9.0   5.2e-26   5.2e-26       2      75 .]      99     171 ..      98     171 .. 0.97
   2 !   78.8   3.1   1.6e-26   1.6e-26       2      75 .]     238     311 ..     237     311 .. 0.98

  Alignments for each domain:
  == domain 1  score: 77.1 bits;  conditional E-value: 5.2e-26
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  aa+++i+++ElGDkT+++aa++a+ry+ l+V++Ga+lAlalmt lsvl+G +  +++p+ ++ +v+ +lF++fG
  NP_035756.2  99 AAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFGYAT-TVIPRVYTYYVSTALFAIFG 171
                  799***********************************************777.89*****************9 PP

  == domain 2  score: 78.8 bits;  conditional E-value: 1.6e-26
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  +a++l+flaE+GD++ql++++Laar +p++V +G ++++ l+t+l+v+ G+++a++++ r+++++++++Fl+f+
  NP_035756.2 238 QALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFA 311
                  899*********************************************************************97 PP



Or compare NP_035756.2 to CDD or PaperBLAST