PaperBLAST – Find papers about a protein or its homologs

 

Align NP_997848.1 to PF01169 (UPF0016)

NP_997848.1 has 305 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.7e-49  150.1  20.4    9.3e-27   79.5   4.2    2.3  2  NP_997848.1  


Domain annotation for each sequence (and alignments):
>> NP_997848.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.4   8.3   8.6e-26   8.6e-26       2      75 .]      79     151 ..      78     151 .. 0.97
   2 !   79.5   4.2   9.3e-27   9.3e-27       2      75 .]     220     293 ..     219     293 .. 0.98

  Alignments for each domain:
  == domain 1  score: 76.4 bits;  conditional E-value: 8.6e-26
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  aa+++i+++ElGDkT+++aa++a+ry+ l+V++Ga+lAl lmt lsvl+G +  + +p+ ++ +++ +lF++fG
  NP_997848.1  79 AAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYAT-TIIPRIYTYYISTALFAIFG 151
                  689***********************************************777.89*****************9 PP

  == domain 2  score: 79.5 bits;  conditional E-value: 9.3e-27
      UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  +a++l+flaE+GD++qla+++Laar +p++V +G +l++ l+t+l+v+ G+++a++++ r+++++++++Fl+f+
  NP_997848.1 220 QALTLTFLAEWGDRSQLATIVLAAREDPFGVAVGGTLGHCLCTGLAVIGGRMVAQKISVRTVTIIGGIVFLAFA 293
                  899*********************************************************************97 PP



Or compare NP_997848.1 to CDD or PaperBLAST