PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10080956 to PF01169 (UPF0016)

VIMSS10080956 has 230 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.1e-47  145.7  13.3      5e-26   77.2   3.4    2.1  2  VIMSS10080956  


Domain annotation for each sequence (and alignments):
>> VIMSS10080956  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.2   3.4     5e-26     5e-26       2      75 .]      10      83 ..       9      83 .. 0.93
   2 !   74.3   2.3   4.2e-25   4.2e-25       2      75 .]     147     220 ..     146     220 .. 0.98

  Alignments for each domain:
  == domain 1  score: 77.2 bits;  conditional E-value: 5e-26
        UPF0016  2 aaflliflaElGDkTqlaaalLaarykplp.VflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75
                   ++++++f++E+GDkT++aaa+La+ry p + V++G++ Al++mt+ls++lG +  +++++++++ ++ +lF+ fG
  VIMSS10080956 10 KSLAMTFVSEIGDKTFFAAAILAMRY-PRRlVLAGCLSALIVMTILSATLGWAAPNLISRKWTHHITTLLFFGFG 83
                   6899**********************.3337********************777788*****************9 PP

  == domain 2  score: 74.3 bits;  conditional E-value: 4.2e-25
        UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                    +af++ f+ E+GDk+qla++ Laa  +p++V+lG v+A +l+t  +v+ G+sla+ ++er++ l +++lF++fG
  VIMSS10080956 147 KAFSINFFGEWGDKSQLATIGLAADENPFGVVLGGVVAQFLCTTAAVIGGKSLASQISERIVALSGGMLFIIFG 220
                    79***********************************************************************9 PP



Or compare VIMSS10080956 to CDD or PaperBLAST