PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084713 to PF01169 (UPF0016)

VIMSS10084713 has 370 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      4e-45  138.4  24.5    1.2e-25   76.0  10.6    2.6  2  VIMSS10084713  


Domain annotation for each sequence (and alignments):
>> VIMSS10084713  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.9   6.0   4.1e-23   4.1e-23       2      75 .]     161     244 ..     160     244 .. 0.86
   2 !   76.0  10.6   1.2e-25   1.2e-25       2      75 .]     288     361 ..     287     361 .. 0.98

  Alignments for each domain:
  == domain 1  score: 67.9 bits;  conditional E-value: 4.1e-23
        UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllG...sslakrlperli.......elvaavlFllfG 75 
                    +afllif++ElGDkT+++aalLaar+++ +Vf+G++ Al +mt++sv+lG   +++ ++lp r+        +++a++l+++fG
  VIMSS10084713 161 SAFLLIFFSELGDKTFFIAALLAARNSAATVFVGTFGALGIMTIISVVLGrtfHYVDEVLPFRFGgtdlpidDIAAVCLLVYFG 244
                    79************************9999********************4444444555555548888999999999999998 PP

  == domain 2  score: 76.0 bits;  conditional E-value: 1.2e-25
        UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                    ++f+l+f+aE+GDk+++ +++Laa ++pl+V++Ga++++ ++t+l+vl Gs l+++l+e+ i +v++vlFl+f+
  VIMSS10084713 288 STFALVFVAEWGDKSFFSTIALAAASSPLGVIAGALAGHGAATLLAVLGGSLLGNFLSEKAIAYVGGVLFLVFA 361
                    79***********************************************************************7 PP



Or compare VIMSS10084713 to CDD or PaperBLAST