PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10100824 to PF01169 (UPF0016)

VIMSS10100824 has 359 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      8e-45  137.4  23.5      1e-24   73.0   7.8    2.3  2  VIMSS10100824  


Domain annotation for each sequence (and alignments):
>> VIMSS10100824  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.2   7.7   7.5e-24   7.5e-24       2      75 .]     148     226 ..     147     226 .. 0.91
   2 !   73.0   7.8     1e-24     1e-24       2      75 .]     278     351 ..     277     351 .. 0.98

  Alignments for each domain:
  == domain 1  score: 70.2 bits;  conditional E-value: 7.5e-24
        UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperli......elvaavlFllfG 75 
                    aaf+lif++E+GDkT+++aalLa++y+   V+lG++ Al lmt+lsv++G+ + + +p ++       e++a++l+++fG
  VIMSS10100824 148 AAFSLIFVSEIGDKTFFIAALLAMQYEKTLVLLGSMGALSLMTILSVVIGKIF-QSVPAQFQttlpigEYAAIALLMFFG 226
                    89************************9999********************888.77777775556677***********9 PP

  == domain 2  score: 73.0 bits;  conditional E-value: 1e-24
        UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                    ++f+l+f+aE+GD+++la+++L+a ++pl+V  Ga+++++++tvl+++ G++la++++e+l+ +v+++lFl+f+
  VIMSS10100824 278 KSFSLVFFAEWGDRSMLATVALGAAQSPLGVASGAIAGHLVATVLAIMGGAFLANYISEKLVGYVGGALFLVFA 351
                    79***********************************************************************7 PP



Or compare VIMSS10100824 to CDD or PaperBLAST