PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS242686 to PF01169 (UPF0016)

VIMSS242686 has 193 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-38  117.9  22.4    8.3e-23   66.9   5.5    2.1  2  VIMSS242686  


Domain annotation for each sequence (and alignments):
>> VIMSS242686  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.2   8.8   8.8e-20   8.8e-20       3      73 ..      10      79 ..       8      81 .. 0.96
   2 !   66.9   5.5   8.3e-23   8.3e-23       3      75 .]     110     183 ..     108     183 .. 0.98

  Alignments for each domain:
  == domain 1  score: 57.2 bits;  conditional E-value: 8.8e-20
      UPF0016  3 aflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFll 73
                 +f+++flaEl DkT la ++L++ry++  Vf+G+++A++l  vl+v++Gs l ++lp++l++ +++vlFl 
  VIMSS242686 10 VFGVVFLAELPDKTALAGLVLGTRYRASYVFAGVAAAFLLHVVLAVAAGSVL-TLLPQQLVHAITGVLFLG 79
                 699**********************9999***********************.9***************95 PP

  == domain 2  score: 66.9 bits;  conditional E-value: 8.3e-23
      UPF0016   3 aflliflaElGDkTqlaaalLaary.kplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   f+li++aE+GD Tq+++a Laary +pl+V lGavlAl+++ +l+++ G++l+kr+p  li+ +aavl+l +G
  VIMSS242686 110 GFMLILVAEFGDLTQIMTANLAARYdDPLSVGLGAVLALWAVAGLGIVGGKALMKRVPLGLITKIAAVLMLGLG 183
                  69*********************************************************************987 PP



Or compare VIMSS242686 to CDD or PaperBLAST