PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS35622 to PF01169 (UPF0016)

VIMSS35622 has 302 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.4e-40  123.8  26.2      4e-24   71.1   4.3    3.0  3  VIMSS35622  


Domain annotation for each sequence (and alignments):
>> VIMSS35622  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   61.9   7.1   2.9e-21   2.9e-21       2      75 .]       7      80 ..       6      80 .. 0.97
   2 !   71.1   4.3     4e-24     4e-24       2      75 .]     107     180 ..     106     180 .. 0.97
   3 ?    1.5   0.6     0.021     0.021      26      46 ..     192     208 ..     187     226 .. 0.53

  Alignments for each domain:
  == domain 1  score: 61.9 bits;  conditional E-value: 2.9e-21
     UPF0016  2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75
                 +++++flaElGD++ql++++   ry+++ V++G+++A + +++++v++G++l++ +p r    v+a++Fl+f+
  VIMSS35622  7 LSLGAVFLAELGDRSQLITMTYTLRYRWWVVLTGVAIAAFTVHGVAVAIGHFLGSTVPARPAACVSAIAFLIFA 80
                5889*********************************************************************7 PP

  == domain 2  score: 71.1 bits;  conditional E-value: 4e-24
     UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                 ++++ ++laElGDkT la+++La+ +++ +V++G++l+++l+++l++ +G  l +rlperl+++++++lFllfG
  VIMSS35622 107 TVVSSFALAELGDKTTLATVTLASDHHWAGVWIGTTLGMILADGLAIGAGLLLHRRLPERLLQVLTGLLFLLFG 180
                 677899********************9999*******************************************9 PP

  == domain 3  score: 1.5 bits;  conditional E-value: 0.021
     UPF0016  26 rykplpVflGavlAlalmtvl 46 
                 r+    V +++++A++l+ + 
  VIMSS35622 192 RS----VAIAVTAAVVLAAAT 208
                 44....444444444433332 PP



Or compare VIMSS35622 to CDD or PaperBLAST