PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6575981 to PF01169 (UPF0016)

VIMSS6575981 has 287 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.9e-44  135.7  22.0    4.2e-25   74.2   3.8    2.6  3  VIMSS6575981  


Domain annotation for each sequence (and alignments):
>> VIMSS6575981  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.1      0.46      0.46      37      46 ..       9      18 ..       7      28 .. 0.58
   2 !   71.2   5.8   3.7e-24   3.7e-24       3      75 .]      53     125 ..      51     125 .. 0.97
   3 !   74.2   3.8   4.2e-25   4.2e-25       2      75 .]     205     278 ..     204     278 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.46
       UPF0016 37 vlAlalmtvl 46
                  ++A++l tv+
  VIMSS6575981  9 IIAVLLSTVV 18
                  3444444444 PP

  == domain 2  score: 71.2 bits;  conditional E-value: 3.7e-24
       UPF0016   3 aflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   ++++if  E+GDkT+++aalLa +++ l+Vf+G++ Al++mt+l+vllG++   ++p++l++++++vlF++fG
  VIMSS6575981  53 SISMIFGCEIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVLFVIFG 125
                   789**********************9999********************9998899****************9 PP

  == domain 3  score: 74.2 bits;  conditional E-value: 4.2e-25
       UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   +af+l+f++E+GD++q+a++++aa  ++++Vf+Ga +++a++t+l+v+ G++++++++ + + +++++lF++fG
  VIMSS6575981 205 KAFALTFVSEWGDRSQIATIAMAASDNVYGVFMGANVGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFG 278
                   79***********************************************************************9 PP



Or compare VIMSS6575981 to CDD or PaperBLAST