PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6577402 to PF01169 (UPF0016)

VIMSS6577402 has 262 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-42  130.0  16.8      3e-24   71.5   2.9    2.1  2  VIMSS6577402  


Domain annotation for each sequence (and alignments):
>> VIMSS6577402  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.5   6.1   4.8e-22   4.8e-22       2      75 .]      29     102 ..      28     102 .. 0.95
   2 !   71.5   2.9     3e-24     3e-24       2      75 .]     181     254 ..     180     254 .. 0.98

  Alignments for each domain:
  == domain 1  score: 64.5 bits;  conditional E-value: 4.8e-22
       UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   +++++i+  ElGDk+++++alLa +y   +Vf+G++lAl++mt ++vl+G++   ++p+++++++++ lFl+fG
  VIMSS6577402  29 MSISMIIGCELGDKSFIVTALLAYQYGRASVFFGSYLALFFMTSFAVLVGRAAPFLFPKSITHILGGTLFLIFG 102
                   5899**********************8889********************8887789****************9 PP

  == domain 2  score: 71.5 bits;  conditional E-value: 3e-24
       UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   +af+lif++ElGD++q+a+++++a+ k+l Vf+G+ ++++l+t+++v++G+++++++++  + ++++++F++fG
  VIMSS6577402 181 KAFALIFVSELGDRSQIATIVMSAKEKVLDVFIGVNIGHMLCTMVAVIVGRYISNKIEMYKVLFFGGIVFMIFG 254
                   79***********************************************************************9 PP



Or compare VIMSS6577402 to CDD or PaperBLAST