PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6630491 to PF01169 (UPF0016)

VIMSS6630491 has 302 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.4e-42  128.4  25.6    4.3e-25   74.2  10.4    2.2  2  VIMSS6630491  


Domain annotation for each sequence (and alignments):
>> VIMSS6630491  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.2  10.4   4.3e-25   4.3e-25       1      75 []      15      89 ..      15      89 .. 0.97
   2 !   60.3   7.3   9.6e-21   9.6e-21       2      75 .]     211     284 ..     210     284 .. 0.98

  Alignments for each domain:
  == domain 1  score: 74.2 bits;  conditional E-value: 4.3e-25
       UPF0016  1 laaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75
                  ++af++i+++E+GDkT+l+aa++a+r+  ++Vf+Ga++ l++m++ls++lG+ + +++p+ ++ ++a vlF++fG
  VIMSS6630491 15 VQAFVMIVVSEIGDKTFLIAAIMATRHPRMTVFAGAFASLVVMSMLSAALGRVILGLIPKLWTLWAASVLFFVFG 89
                  589************************7777*******************************************9 PP

  == domain 2  score: 60.3 bits;  conditional E-value: 9.6e-21
       UPF0016   2 aaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                   +af+l+fl E+GD++q++++++a  +++  + +G+++++ ++t  +vl G++l+++++ + i l++a++F++f+
  VIMSS6630491 211 QAFVLTFLGEWGDRSQITTIAMAGAHSVAVIAFGTIVGHGVCTCGAVLGGRYLSTKISVKHISLLGAAAFIIFA 284
                   79************************9999*******************************************7 PP



Or compare VIMSS6630491 to CDD or PaperBLAST