PaperBLAST – Find papers about a protein or its homologs

 

Align XP_754898.1 to PF01169 (UPF0016)

XP_754898.1 has 541 amino acids

Query:       UPF0016  [M=75]
Accession:   PF01169.19
Description: Uncharacterized protein family UPF0016
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.1e-40  123.3  26.0    5.8e-25   73.8   9.2    2.7  2  XP_754898.1  


Domain annotation for each sequence (and alignments):
>> XP_754898.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.8   9.2   5.8e-25   5.8e-25       3      75 .]     257     329 ..     255     329 .. 0.96
   2 !   54.8   8.4   4.8e-19   4.8e-19       1      75 []     439     532 ..     439     532 .. 0.86

  Alignments for each domain:
  == domain 1  score: 73.8 bits;  conditional E-value: 5.8e-25
      UPF0016   3 aflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperlielvaavlFllfG 75 
                  +f++i+++E+GDkT+l+aal+a+r+  l Vf +a+ Al+ mtvls++lG+++ +++p+++++++aavlF++fG
  XP_754898.1 257 SFTMIVVSEIGDKTFLVAALMAMRHPRLLVFSAAFSALIGMTVLSAILGHAVPTLIPKSVTKFLAAVLFIVFG 329
                  8************************5556*******************************************9 PP

  == domain 2  score: 54.8 bits;  conditional E-value: 4.8e-19
      UPF0016   1 laaflliflaElGDkTqlaaalLaarykplpVflGavlAlalmtvlsvllGsslakrlperli...................elvaavlFllfG 75 
                  +++f+++fl E+GD++q+a++++aa +++++V++Ga+ ++ ++t+ +v+ G+++a+++++r+                    +l +a+++l+fG
  XP_754898.1 439 VQTFVMTFLGEWGDRSQIATIAMAAGQDYWWVTVGAISGHGICTAAAVIGGAAIAGKVSMRVGmytlvlpwpfehmltfhpvTLGGAAALLIFG 532
                  589*********************************************************9975666666666666666666677777777666 PP



Or compare XP_754898.1 to CDD or PaperBLAST