PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::B9MK94 to PF01170 (UPF0020)

BRENDA::B9MK94 has 416 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-13   36.4   0.0    4.3e-09   22.4   0.0    2.4  2  BRENDA::B9MK94  


Domain annotation for each sequence (and alignments):
>> BRENDA::B9MK94  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.4   0.0   4.3e-09   4.3e-09       9      54 ..      33      77 ..      30      98 .. 0.83
   2 !   11.5   0.0   9.8e-06   9.8e-06     102     136 ..     221     256 ..     166     272 .. 0.78

  Alignments for each domain:
  == domain 1  score: 22.4 bits;  conditional E-value: 4.3e-09
                    --SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT-- CS
         UPF0020  9 papLketLAaalvrlagwkpgepllDPmCGsGtilIEaallgania 54
                    pa + + LA  l++ +  k+++  lDP+CGsGt+l Ea   g+n++
  BRENDA::B9MK94 33 PAMMPAPLAEFLIQ-SFTKKNDIVLDPFCGSGTVLYEALKNGRNAI 77
                    67777777776665.567889999*************988887776 PP

  == domain 2  score: 11.5 bits;  conditional E-value: 9.8e-06
                     GGGEEEEE--GGG--.STTS---EEEE--------- CS
         UPF0020 102 gdliefsqadaakLr.lkegevdvivtnpPYGerlg 136
                     ++ +++  +++ +L   +++ vd+i+t pPYG++ +
  BRENDA::B9MK94 221 SNYVKIFHKNILDLDeVENETVDLILTSPPYGDART 256
                     556777788899999666779***********9754 PP



Or compare BRENDA::B9MK94 to CDD or PaperBLAST