PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::O52711 to PF01170 (UPF0020)

BRENDA::O52711 has 376 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.6e-13   34.7   0.0    1.7e-10   27.0   0.0    2.2  2  BRENDA::O52711  


Domain annotation for each sequence (and alignments):
>> BRENDA::O52711  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.0   0.0   1.7e-10   1.7e-10       6      54 ..      38      85 ..      35     142 .. 0.81
   2 !    5.6   0.0   0.00062   0.00062     109     134 ..     235     262 ..     211     270 .. 0.84

  Alignments for each domain:
  == domain 1  score: 27.0 bits;  conditional E-value: 1.7e-10
                    SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT-- CS
         UPF0020  6 fngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallgania 54
                    + ++++Lk++LA  lv+    + g + lDPm G Gti+ Eaal g+  +
  BRENDA::O52711 38 CSYQGKLKPSLAHWLVKTFSPE-GGTVLDPMGGVGTIAFEAALTGRVGI 85
                    56899***********988776.56788***************987655 PP

  == domain 2  score: 5.6 bits;  conditional E-value: 0.00062
                     E--GGG--.STTS---EEEE----.--- CS
         UPF0020 109 qadaakLr.lkegevdvivtnpPY.Ger 134
                     + d+++L  + ++ vd+i+t pP+ G r
  BRENDA::O52711 235 EGDFRDLSeHINEPVDAIITSPPFmGMR 262
                     6799999976788**********95555 PP



Or compare BRENDA::O52711 to CDD or PaperBLAST