PaperBLAST – Find papers about a protein or its homologs

 

Align NP_973978.2 to PF01170 (UPF0020)

NP_973978.2 has 538 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-10   26.6   0.0    3.8e-10   25.9   0.0    1.3  1  NP_973978.2  


Domain annotation for each sequence (and alignments):
>> NP_973978.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.9   0.0   3.8e-10   3.8e-10      75     132 ..     389     445 ..     360     495 .. 0.90

  Alignments for each domain:
  == domain 1  score: 25.9 bits;  conditional E-value: 3.8e-10
                  HH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----- CS
      UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132
                  +   ++++Dld++ ++ a+ Na  +gv+d+i+f++ d+ +L   + + +++   pP+G
  NP_973978.2 389 RSHYVIAIDLDPKKLDLAKHNAAIYGVADKIDFVKGDFFDLA-HNLKAGTVFLSPPWG 445
                  445599************************************.9999**********9 PP



Or compare NP_973978.2 to CDD or PaperBLAST