Q9F8B8 has 254 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-12 33.3 0.1 3.1e-12 32.7 0.1 1.3 1 Q9F8B8 Domain annotation for each sequence (and alignments): >> Q9F8B8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.7 0.1 3.1e-12 3.1e-12 76 127 .. 64 115 .. 25 117 .. 0.85 Alignments for each domain: == domain 1 score: 32.7 bits; conditional E-value: 3.1e-12 UPF0020 76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127 ++ ++Dld++v+++a+eN +ka+++++ie+ q +a kL+ +++++d+++ Q9F8B8 64 SCHITALDLDSKVIEKAKENVKKAQLEEFIEVIQGNALKLPFPDNSFDIVIN 115 44599************************************9999****995 PP
Or compare Q9F8B8 to CDD or PaperBLAST