PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Aba401I to PF01170 (UPF0020)

REBASE::M.Aba401I has 493 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.5e-13   34.7   0.0    1.4e-12   33.8   0.0    1.4  1  REBASE::M.Aba401I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Aba401I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.8   0.0   1.4e-12   1.4e-12      19     145 ..     172     293 ..     167     351 .. 0.69

  Alignments for each domain:
  == domain 1  score: 33.8 bits;  conditional E-value: 1.4e-12
                        HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHH.HH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEE CS
            UPF0020  19 alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeear.aelklygsDldrrvvqgareNaekagvgdl.iefs 108
                         +v+l + kp++++ DP CG+ ++l+ a    ++ +        +e+ a+ e+++r  e  ++g D+d+ +++ +  N    gv++  ie +
  REBASE::M.Aba401I 172 MIVELMQPKPTDTICDPACGTAGFLVAASEYLNEHYS-------TEIFANPEAAKRfSEETFFGYDFDSTMLRIGSMNMMLHGVENPrIENR 256
                        589999********************99887777773.......33344445555545667***********************98526666 PP

                        E--GGG--STTS---EEEE----------HHHHHHHH CS
            UPF0020 109 qadaakLrlkegevdvivtnpPYGerlgskkalekLY 145
                        +    +  +  +++ +i++npP+  +l+++   +++ 
  REBASE::M.Aba401I 257 DSLSEAHSHIAEKYSLILANPPFAGSLDNESCAKNIQ 293
                        6544444456669************999887655543 PP



Or compare REBASE::M.Aba401I to CDD or PaperBLAST