PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.AspRAC01I to PF01170 (UPF0020)

REBASE::M.AspRAC01I has 520 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    4.6e-13   35.4   0.0      8e-13   34.6   0.0    1.3  1  REBASE::M.AspRAC01I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.AspRAC01I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.6   0.0     8e-13     8e-13      20     148 ..     182     304 ..     177     360 .. 0.77

  Alignments for each domain:
  == domain 1  score: 34.6 bits;  conditional E-value: 8e-13
                          HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEE CS
              UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefs 108
                          +v l+  +p++++ DP +G+ ++l+ a+   ++ +p +l       +  a+++  ++  + g D+d+ +++ +  N    gv++  ie++
  REBASE::M.AspRAC01I 182 MVALTAPTPQDTICDPASGTCGFLVAAGEYLRRTYPDML-------RVPAQNAHFHHGMFHGYDFDNTMLRIGSMNMVLHGVEHPaIEYR 264
                          99**********************************888.......4444545557777************************9549999 PP

                          E--GGG--STTS---EEEE----------HHHHHHHHHHH CS
              UPF0020 109 qadaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                          +   +    + + + +i++npP+  +l+++ + ++L s +
  REBASE::M.AspRAC01I 265 DSLSQGAAGDADAYSLILANPPFAGSLDHESTAKDLQSIV 304
                          9999988877779****************99999997643 PP



Or compare REBASE::M.AspRAC01I to CDD or PaperBLAST