PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Bau1417II to PF01170 (UPF0020)

REBASE::M.Bau1417II has 490 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.3e-16   47.0   0.0    2.2e-16   46.3   0.0    1.3  1  REBASE::M.Bau1417II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Bau1417II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.3   0.0   2.2e-16   2.2e-16      20     149 ..     175     298 ..     170     354 .. 0.80

  Alignments for each domain:
  == domain 1  score: 46.3 bits;  conditional E-value: 2.2e-16
                          HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEE CS
              UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefs 108
                          +v+++  +p++ + DP CG+ ++l+ a  + ++  p  +        ++ ++++ ++  + g D+d+ +++ +  N    g+++  i ++
  REBASE::M.Bau1417II 175 MVKMSAPRPDDEICDPACGTAGFLVSASEQLRHSHPEVF-------TNKEQRHFFHNSMFHGYDFDSTMLRIGSMNMMLHGIEQPdIRYR 257
                          9**********************************9888.......3333333347777***********************9855**** PP

                          E--GGG--STTS---EEEE----------HHHHHHHHHHHH CS
              UPF0020 109 qadaakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149
                          +  a ++ ++ +++ +i++npP+  +l+ + + ++L + + 
  REBASE::M.Bau1417II 258 DSLAENVSAEAEKYTLILANPPFAGSLDYEAMSQDLQRVVK 298
                          ********88889*****************99999988643 PP



Or compare REBASE::M.Bau1417II to CDD or PaperBLAST