PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Bau1420I to PF01170 (UPF0020)

REBASE::M.Bau1420I has 490 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    2.2e-15   43.0   0.0    3.6e-15   42.3   0.0    1.3  1  REBASE::M.Bau1420I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Bau1420I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.3   0.0   3.6e-15   3.6e-15      20     149 ..     175     298 ..     170     354 .. 0.80

  Alignments for each domain:
  == domain 1  score: 42.3 bits;  conditional E-value: 3.6e-15
                         HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE CS
             UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsq 109
                         +v+++  +p++ + DP CG+ ++l+ a  + ++  p  +        ++ ++++ ++  + g D+d+ +++ +  N    g+++  i +++
  REBASE::M.Bau1420I 175 MVKMSAPRPDDEICDPACGTAGFLVSASEQLRESHPEVF-------TNKEQRHFFHNSMFHGYDFDSTMLRIGSMNMMLHGIEQPdIRYRD 258
                         9**********************************9888.......3333333347777***********************9855***** PP

                         --GGG--STTS---EEEE----------HHHHHHHHHHHH CS
             UPF0020 110 adaakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149
                             ++ ++ +++ +i++npP+  +l+ + + ++L + + 
  REBASE::M.Bau1420I 259 SLSENFSAEVEKYTLILANPPFAGSLDYEATSQDLQRVVK 298
                         *******88889***************9999999987643 PP



Or compare REBASE::M.Bau1420I to CDD or PaperBLAST