PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Cbo67071II to PF01170 (UPF0020)

REBASE::M.Cbo67071II has 486 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    8.3e-12   31.3   0.0    2.3e-11   29.9   0.0    1.8  2  REBASE::M.Cbo67071II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Cbo67071II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.4   0.0      0.36      0.36     142     164 ..      81     103 ..      76     121 .. 0.68
   2 !   29.9   0.0   2.3e-11   2.3e-11      18     141 ..     166     282 ..     162     324 .. 0.84

  Alignments for each domain:
  == domain 1  score: -3.4 bits;  conditional E-value: 0.36
                           HHHHHHHHHHHHHH-TT..-EEE CS
               UPF0020 142 ekLYseflrelkrvlrgggrlvl 164
                           ++ Y+ +l+e+ ++++g+ r ++
  REBASE::M.Cbo67071II  81 KRYYNTILDEFGENCKGRVREIY 103
                           56688888888888887555444 PP

  == domain 2  score: 29.9 bits;  conditional E-value: 2.3e-11
                           HHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEE CS
               UPF0020  18 aalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdlie 106
                            ++v+l + kpge   DP CG+ ++ I a    ++          l++++  e+e++++  + g +l +   + a  Na    ++++i 
  REBASE::M.Cbo67071II 166 NVMVKLVDPKPGELCNDPACGTFGFMIAADKHIKENTDD------LFALEFDEQEFQKKKAFTGCELVHDTHRLALMNAMLHDIEGEII 248
                           58*************************886655555533......4466666666777778**************************** PP

                           EEE--GGG--STTS---EEEE----------HHHH CS
               UPF0020 107 fsqadaakLrlkegevdvivtnpPYGerlgskkal 141
                           + +    ++ ++ + +dv++tnpP+G + g ++a 
  REBASE::M.Cbo67071II 249 LGDT-LSNVGKSMKGFDVVLTNPPFGTKKGGERAT 282
                           **95.5556656668***********999988887 PP



Or compare REBASE::M.Cbo67071II to CDD or PaperBLAST