REBASE::M.Cdi81II has 487 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-10 26.6 0.0 4.3e-10 25.7 0.0 1.4 1 REBASE::M.Cdi81II Domain annotation for each sequence (and alignments): >> REBASE::M.Cdi81II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.7 0.0 4.3e-10 4.3e-10 20 144 .. 173 290 .. 168 347 .. 0.80 Alignments for each domain: == domain 1 score: 25.7 bits; conditional E-value: 4.3e-10 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110 +vrl + ++++ ++DP Gs ++l+ + ++ +l + ++e++++ +yg+D+dr +++ + N gv++ ie+++ REBASE::M.Cdi81II 173 IVRLIKPTPEDIIVDPAAGSAGFLVSSQQYLRDNHS------SLFLVQGLKEHFNN-GMFYGFDMDRTMLRIGAMNMMLHGVDNPnIEYKD- 256 799999******************987777766663......33466666666654.459**********************986266666. PP UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekL 144 +++ +++++ ++++npP+ +l+ + +L REBASE::M.Cdi81II 257 SLSEVNTDKDKFTLVLANPPFKGSLDYEAVSADL 290 7778998999***********9998877665555 PP
Or compare REBASE::M.Cdi81II to CDD or PaperBLAST