PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.CdiG46I to PF01170 (UPF0020)

REBASE::M.CdiG46I has 487 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.1e-10   26.7   0.0    3.9e-10   25.9   0.0    1.4  1  REBASE::M.CdiG46I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.CdiG46I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.9   0.0   3.9e-10   3.9e-10      20     144 ..     173     290 ..     168     347 .. 0.81

  Alignments for each domain:
  == domain 1  score: 25.9 bits;  conditional E-value: 3.9e-10
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE- CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110
                        +vrl + +p++ ++DP  Gs ++l+   +  ++          l+l + ++e++++   +yg+D+dr +++ +  N    gv++  ie+++ 
  REBASE::M.CdiG46I 173 IVRLIKPTPEDIIVDPAAGSAGFLVSSQQYLRDNHS------SLFLVQGLKEHFNN-GMFYGFDMDRTMLRIGAMNMMLHGVDNPnIEYKD- 256
                        799999******************988777776663......33466666666654.459**********************986266666. PP

                        -GGG--STTS---EEEE----------HHHHHHH CS
            UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekL 144
                           +++ +++++ ++++npP+  +l+ +    +L
  REBASE::M.CdiG46I 257 SLSEVNTDKDKFTLVLANPPFKGSLDYEAVSADL 290
                        7788998999***********9998877665555 PP



Or compare REBASE::M.CdiG46I to CDD or PaperBLAST