PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.EsaWC2II to PF01170 (UPF0020)

REBASE::M.EsaWC2II has 428 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    1.2e-10   27.5   0.0    2.2e-09   23.4   0.0    2.4  2  REBASE::M.EsaWC2II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.EsaWC2II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.4   0.0   2.2e-09   2.2e-09      10      54 ..      54      97 ..      48     135 .. 0.78
   2 ?    1.0   0.0     0.016     0.016     110     131 ..     218     239 ..     212     249 .. 0.88

  Alignments for each domain:
  == domain 1  score: 23.4 bits;  conditional E-value: 2.2e-09
                        -SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT-- CS
             UPF0020 10 apLketLAaalvrlagwkpgepllDPmCGsGtilIEaallgania 54
                        ++ +++L  al+r a + pg++ lDP+ GsGt+lIE a lg  ++
  REBASE::M.EsaWC2II 54 GQFSPQLVEALLR-AYAAPGSVVLDPFMGSGTVLIESARLGLPVY 97
                        6677888888885.7899********************9998777 PP

  == domain 2  score: 1.0 bits;  conditional E-value: 0.016
                         --GGG--STTS---EEEE---- CS
             UPF0020 110 adaakLrlkegevdvivtnpPY 131
                          da++++l++g +d +++ pPY
  REBASE::M.EsaWC2II 218 GDARAMPLSDGTIDFVLSSPPY 239
                         58899999999*********** PP



Or compare REBASE::M.EsaWC2II to CDD or PaperBLAST