PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Ftu2015II to PF01170 (UPF0020)

REBASE::M.Ftu2015II has 495 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    4.3e-12   32.2   0.1    3.2e-10   26.2   0.1    2.7  2  REBASE::M.Ftu2015II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Ftu2015II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.2   0.1   3.2e-10   3.2e-10      17     131 ..     191     287 ..     187     307 .. 0.61
   2 ?   -3.1   0.0      0.29      0.29     147     179 ..     318     350 ..     316     358 .. 0.77

  Alignments for each domain:
  == domain 1  score: 26.2 bits;  conditional E-value: 3.2e-10
                          HHHHHHHTT--TTS-EEETT-TTSHHHHHHHHH.HTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGE CS
              UPF0020  17 AaalvrlagwkpgepllDPmCGsGtilIEaall.ganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdli 105
                          ++ l +l ++k+g+ ++DP CGsG++lI aa   g+n  ++             +e++ ++ +l+ +++          N+ + ++gd+i
  REBASE::M.Ftu2015II 191 SSLLAMLVQAKEGDEIYDPTCGSGSLLIKAAKEiGSNNFAIYG-----------QERNSTTHSLCRMNMFLH-----DINDANIQLGDTI 264
                          566889999**********************751555554333...........222223333433443333.....3345555555555 PP

                          EEEE.--GGG--STTS---EEEE---- CS
              UPF0020 106 efsq.adaakLrlkegevdvivtnpPY 131
                               +++ kL+    ++dv+v+npP+
  REBASE::M.Ftu2015II 265 RNPRiLENDKLK----KFDVVVANPPF 287
                          443303333444....57777777777 PP

  == domain 2  score: -3.1 bits;  conditional E-value: 0.29
                          HHHHHHHHH-TT..-EEEEEESSHHHHHCC--- CS
              UPF0020 147 eflrelkrvlrgggrlvlltsenkalekaleer 179
                          +f + +   l+++gr+++++++   +  a+e +
  REBASE::M.Ftu2015II 318 AFIQHMLASLNESGRMAVVVPHGVLFRGAAEGK 350
                          577888888999999999999888877777655 PP



Or compare REBASE::M.Ftu2015II to CDD or PaperBLAST