PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Gba708I to PF01170 (UPF0020)

REBASE::M.Gba708I has 528 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      7e-11   28.3   0.0    5.8e-10   25.3   0.0    2.3  2  REBASE::M.Gba708I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Gba708I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.3   0.0   5.8e-10   5.8e-10      17     134 ..     186     299 ..     183     307 .. 0.77
   2 ?   -1.1   0.0     0.074     0.074     147     180 ..     333     366 ..     330     381 .. 0.80

  Alignments for each domain:
  == domain 1  score: 25.3 bits;  conditional E-value: 5.8e-10
                        HHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEE CS
            UPF0020  17 AaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdliefs 108
                         +a+v     +pge+ +DP CG+G++l+ a   + +  p l r         a+++  +   l g +l   v + +  N+   g+g +    
  REBASE::M.Gba708I 186 IRAIVDCVAPRPGETVADPACGTGGFLLAAHDYVVRHHPSLDR---------AQKRHLKLEALHGTELVDGVARLCAMNLLLHGIGPTAGDT 268
                        589999999*******************999999998886665.........4554445555889999999999999999999888776555 PP

                        E--GGG--.....STTS---EEEE------- CS
            UPF0020 109 qadaakLr.....lkegevdvivtnpPYGer 134
                        +a a  +       + + ++vi+tnpP+G++
  REBASE::M.Gba708I 269 AAPAVRVDdalraDPGQRFEVILTNPPFGRK 299
                        555544444333445669***********86 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.074
                        HHHHHHHHH-TT..-EEEEEESSHHHHHCC---E CS
            UPF0020 147 eflrelkrvlrgggrlvlltsenkalekaleera 180
                        +f + +k  l+ ggr+++++++n  +e  ++e  
  REBASE::M.Gba708I 333 AFVQHVKTLLKIGGRAAVVVPDNVLFEGGAGETV 366
                        688999999**************99998887773 PP



Or compare REBASE::M.Gba708I to CDD or PaperBLAST