PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Hma11271I to PF01170 (UPF0020)

REBASE::M.Hma11271I has 492 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    3.4e-15   42.4   0.1    9.7e-15   40.9   0.0    1.7  2  REBASE::M.Hma11271I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Hma11271I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.9   0.0   9.7e-15   9.7e-15      16     135 ..     156     265 ..     153     283 .. 0.82
   2 ?   -2.9   0.0      0.25      0.25     148     179 ..     300     331 ..     291     345 .. 0.74

  Alignments for each domain:
  == domain 1  score: 40.9 bits;  conditional E-value: 9.7e-15
                          HHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GG.. CS
              UPF0020  16 LAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgd.. 103
                          L  a+v++ + kp+++ +DP CG+G++l+ a    a  a            ++ e+++ ++  ++g D+  +vv+ +  N+   g+g+  
  REBASE::M.Hma11271I 156 LIQAMVEVMQPKPTDVVADPACGTGGFLLAAHDYMAPQA---A--------SKPEKKFLRNDAFRGNDIVDSVVRLCAMNLYLHGIGGad 234
                          6689*************************8864444444...2........344555556667*********************999833 PP

                          .GEEEEE--GGG--STTS---EEEE-------- CS
              UPF0020 104 .liefsqadaakLrlkegevdvivtnpPYGerl 135
                            i  ++a a+++   e++vd++++npP+G++ 
  REBASE::M.Hma11271I 235 cPILNQDALAKSVG--EDKVDIVLANPPFGKKS 265
                          35888888888887..668***********975 PP

  == domain 2  score: -2.9 bits;  conditional E-value: 0.25
                          HHHHHHHH-TT..-EEEEEESSHHHHHCC--- CS
              UPF0020 148 flrelkrvlrgggrlvlltsenkalekaleer 179
                          f + ++++l+ +g++++++++n  +e  ++e 
  REBASE::M.Hma11271I 300 FVQHIANMLKVNGKAAVVLPDNVLFEGGAGET 331
                          77888888999999999999999888766665 PP



Or compare REBASE::M.Hma11271I to CDD or PaperBLAST