PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Hpy32VII to PF01170 (UPF0020)

REBASE::M.Hpy32VII has 545 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    7.6e-10   24.9   0.0    2.3e-09   23.4   0.0    1.8  1  REBASE::M.Hpy32VII  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Hpy32VII  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.4   0.0   2.3e-09   2.3e-09      78     144 ..     160     224 ..     132     250 .. 0.85

  Alignments for each domain:
  == domain 1  score: 23.4 bits;  conditional E-value: 2.3e-09
                         -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHH CS
             UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekL 144
                         ++yg D d+ +++ +++  ++    d  ++ q+d+ +L+  + ++d i tnpP+G++ +++++ e++
  REBASE::M.Hpy32VII 160 NIYGYDTDAFAIALTKKRIKERYHLDCPNIMQKDFLNLK-HTPQFDCIFTNPPWGKKYNQNQK-ENF 224
                         49*************************************.8889*************988764.444 PP



Or compare REBASE::M.Hpy32VII to CDD or PaperBLAST