PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.HpyFVII to PF01170 (UPF0020)

REBASE::M.HpyFVII has 545 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.9e-10   26.3   0.2    1.9e-09   23.6   0.0    2.3  2  REBASE::M.HpyFVII  


Domain annotation for each sequence (and alignments):
>> REBASE::M.HpyFVII  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.6   0.0       0.1       0.1     131     158 ..      81     108 ..      79     126 .. 0.82
   2 !   23.6   0.0   1.9e-09   1.9e-09      78     140 ..     160     221 ..     132     236 .. 0.87

  Alignments for each domain:
  == domain 1  score: -1.6 bits;  conditional E-value: 0.1
                        -------HHHHHHHHHHHHHHHHHH-TT CS
            UPF0020 131 YGerlgskkalekLYseflrelkrvlrg 158
                        Y +rl++  +lekL s+  +el++ +r+
  REBASE::M.HpyFVII  81 YLKRLENSSDLEKLGSSYEEELSNTTRN 108
                        999***********99999999998876 PP

  == domain 2  score: 23.6 bits;  conditional E-value: 1.9e-09
                        -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHH CS
            UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskka 140
                        ++yg D d+ +++ +++  ++    d  +++q+d+ +L+  + ++d i tnpP+G++ +++++
  REBASE::M.HpyFVII 160 NIYGYDTDAFAIALTKKRIKERYHLDCPNIVQKDFLNLK-HTPQFDCIFTNPPWGKKYNQNQK 221
                        49*************************************.8889************9988765 PP



Or compare REBASE::M.HpyFVII to CDD or PaperBLAST