PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.LlaA17I to PF01170 (UPF0020)

REBASE::M.LlaA17I has 516 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-10   27.3   0.2    5.5e-09   22.1   0.0    3.0  2  REBASE::M.LlaA17I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.LlaA17I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   0.0     0.034     0.034      75     105 ..      80     110 ..      43     126 .. 0.73
   2 !   22.1   0.0   5.5e-09   5.5e-09      10     133 ..     201     308 ..     195     314 .. 0.76

  Alignments for each domain:
  == domain 1  score: -0.1 bits;  conditional E-value: 0.034
                        HH--EEEEES-HHHHHHHHHHHHHTT-GGGE CS
            UPF0020  75 aelklygsDldrrvvqgareNaekagvgdli 105
                        + + ++ s l ++vv++areN+   +  ++i
  REBASE::M.LlaA17I  80 KGYYIAPSQLFSNVVKTARENDDLNTKLKEI 110
                        444588899999*********9765544444 PP

  == domain 2  score: 22.1 bits;  conditional E-value: 5.5e-09
                        -SS-HHHHH.HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT CS
            UPF0020  10 apLketLAa.alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekag 100
                         + ++ LA  +++   ++++ ++++DP CGsG++l+ a  + ++ +                     e  ++g +++    + ar N    +
  REBASE::M.LlaA17I 201 QSVSALLAKiVMLGKDEQNKINKIYDPACGSGSLLLQARKQFSEHII--------------------EEGFFGQEINMTTYNLARMNMFLHN 272
                        55566666424666667777789***************998888872....................34499***************87666 PP

                        -G.GG..EEEEE--GGG--STTS---EEEE------ CS
            UPF0020 101 vg.dl..iefsqadaakLrlkegevdvivtnpPYGe 133
                        ++ d+  i+  +  +  L+++++ +d+iv+npPY +
  REBASE::M.LlaA17I 273 INyDKfdIKRGDTLINPLHNDDKPFDAIVSNPPYSI 308
                        64344125555666889999999***********75 PP



Or compare REBASE::M.LlaA17I to CDD or PaperBLAST