PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.MfoCT6I to PF01170 (UPF0020)

REBASE::M.MfoCT6I has 506 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.4e-14   37.7   0.0    1.5e-13   37.0   0.0    1.3  1  REBASE::M.MfoCT6I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.MfoCT6I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.0   0.0   1.5e-13   1.5e-13      20     149 ..     191     314 ..     185     367 .. 0.84

  Alignments for each domain:
  == domain 1  score: 37.0 bits;  conditional E-value: 1.5e-13
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE- CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110
                        +v+++  kp++ + DP CG+ ++l+ a   +++          + l + a+++  ++  + g D+d+ +++ +  N    g++   i +++ 
  REBASE::M.MfoCT6I 191 MVKMTAPKPTDEICDPACGTAGFLVAASEYVRSTHE-------SVLTDAAQRKHFHNSMFHGYDFDSTMLRIGSMNMLMHGIESPdIRYRDS 275
                        9************************77777766662.......2244444555557888***********************9854999999 PP

                        -GGG--STTS---EEEE----------HHHHHHHHHHHH CS
            UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149
                              ++ +++ +i++npP+  +l+ + + ++L + + 
  REBASE::M.MfoCT6I 276 LSEGASEDAEKYTLILANPPFAGSLDYESTSKDLQRVVK 314
                        9999999999****************9999999987654 PP



Or compare REBASE::M.MfoCT6I to CDD or PaperBLAST