PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Nfa11134II to PF01170 (UPF0020)

REBASE::M.Nfa11134II has 514 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    2.2e-11   30.0   0.0    3.7e-11   29.2   0.0    1.3  1  REBASE::M.Nfa11134II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Nfa11134II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.2   0.0   3.7e-11   3.7e-11      20     146 ..     178     298 ..     172     356 .. 0.75

  Alignments for each domain:
  == domain 1  score: 29.2 bits;  conditional E-value: 3.7e-11
                           HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEE CS
               UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.ief 107
                           +v +   kpg++++DP +G+ ++l+ a    +   + ++        + a ++  ++  + g+D+d+ +++ +  N    g+++  i +
  REBASE::M.Nfa11134II 178 MVHMMAPKPGDTIVDPASGTCGFLVAASEYMRAHHADAI-------NSGAGKHHYHHKMFHGFDFDNTMLRIGSMNMLLHGIEQPdIRY 259
                           999999*******************88755444443333.......2333333334455***********************9854999 PP

                           EE--GGG--STTS---EEEE----------HHHHHHHHH CS
               UPF0020 108 sqadaakLrlkegevdvivtnpPYGerlgskkalekLYs 146
                           ++  a + + + + + ++++npP+  +l+ +++ ++L +
  REBASE::M.Nfa11134II 260 RDSLAEANTGDAEAYSLVLANPPFAGSLDYENTAKDLQQ 298
                           99888888866668***************9999988865 PP



Or compare REBASE::M.Nfa11134II to CDD or PaperBLAST