PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Nsp51109I to PF01170 (UPF0020)

REBASE::M.Nsp51109I has 751 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      1e-10   27.7   0.0    1.3e-09   24.2   0.0    2.6  2  REBASE::M.Nsp51109I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Nsp51109I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.2   0.0   1.3e-09   1.3e-09       5     134 ..      87     195 ..      83     211 .. 0.71
   2 ?   -1.2   0.0     0.077     0.077      14      38 ..     646     670 ..     643     671 .. 0.95

  Alignments for each domain:
  == domain 1  score: 24.2 bits;  conditional E-value: 1.3e-09
                          -SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHH...HHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHH CS
              UPF0020   5 efngpapLketLAaalvrlagwkpgepllDPmCGsGtilI...EaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqg 91 
                          +++ p  L   LA   ++     ++ + lDP CG G +l+   Eaa l                         ++l+l+g Dld+++v+ 
  REBASE::M.Nsp51109I  87 HYT-PERLARFLAERVLEHVAPGEELRVLDPACGEGELLLalhEAAALRCPG---------------------VRLRLVGYDLDAEAVRV 154
                          555.556666777777777778888899999999999987333333332222.....................5789************* PP

                          HHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE------- CS
              UPF0020  92 areNaekagvgdliefsqadaakLrlkegevdvivtnpPYGer 134
                          are   +  v+  +      a +L   ++++d+++tnpPY + 
  REBASE::M.Nsp51109I 155 ARERGGRLAVEWHVGDFLRAAEELA--DDSFDAVITNPPYVRT 195
                          **99988877655554444555565..669**********764 PP

  == domain 2  score: -1.2 bits;  conditional E-value: 0.077
                          HHHHHHHHHHTT--TTS-EEETT-T CS
              UPF0020  14 etLAaalvrlagwkpgepllDPmCG 38 
                          etLA+ l+ +a+ + g + +D  CG
  REBASE::M.Nsp51109I 646 ETLAYLLMGVANSTLGLRYYDAVCG 670
                          89**********************9 PP



Or compare REBASE::M.Nsp51109I to CDD or PaperBLAST