PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PbaD4II to PF01170 (UPF0020)

REBASE::M.PbaD4II has 418 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.7e-13   35.7   0.0    3.8e-09   22.6   0.0    2.3  2  REBASE::M.PbaD4II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PbaD4II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.6   0.0   3.8e-09   3.8e-09       8      54 ..      29      74 ..      21     103 .. 0.82
   2 !   10.7   0.0   1.7e-05   1.7e-05     112     137 ..     237     260 ..     219     277 .. 0.74

  Alignments for each domain:
  == domain 1  score: 22.6 bits;  conditional E-value: 3.8e-09
                       ---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT-- CS
            UPF0020  8 gpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallgania 54
                       +pa + +++A  l++  g +  ++l+DP CGsGt l+Ea + g n++
  REBASE::M.PbaD4II 29 YPAMMIPQIANRLIKYYGSD-AQQLFDPYCGSGTSLVEANVNGINAV 74
                       68999999999999999975.5789**************99999987 PP

  == domain 2  score: 10.7 bits;  conditional E-value: 1.7e-05
                        GGG--STTS---EEEE---------- CS
            UPF0020 112 aakLrlkegevdvivtnpPYGerlgs 137
                        +    lk++e+d++vt pPYG++ ++
  REBASE::M.PbaD4II 237 VEP--LKSSEIDLVVTSPPYGDSRTT 260
                        333..45779***********98665 PP



Or compare REBASE::M.PbaD4II to CDD or PaperBLAST