PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PfrJS11I to PF01170 (UPF0020)

REBASE::M.PfrJS11I has 534 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    2.7e-15   42.7   0.0    4.7e-15   41.9   0.0    1.4  1  REBASE::M.PfrJS11I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PfrJS11I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   41.9   0.0   4.7e-15   4.7e-15      20     148 ..     219     341 ..     213     396 .. 0.82

  Alignments for each domain:
  == domain 1  score: 41.9 bits;  conditional E-value: 4.7e-15
                         HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--.EEEEES-HHHHHHHHHHHHHTT-GG.GEEEE CS
             UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefs 108
                         +v +   +p++++ DP CG+ ++lI a   +++  p +l        +  + + +++ + + g+D+d+ +++ a  N    g+++ +++++
  REBASE::M.PfrJS11I 219 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRDHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYR 301
                         999999*********************999999998665........4445555544446***********************87357777 PP

                         E--GGG--STTS---EEEE----------HHHHHHHHHHH CS
             UPF0020 109 qadaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                         +        +eg++ ++++npP+  +l+ + + ++L + +
  REBASE::M.PfrJS11I 302 DSLSEGAADDEGSYSLVLANPPFAGSLDYESTSKDLQQVV 341
                         777777778999****************999999997764 PP



Or compare REBASE::M.PfrJS11I to CDD or PaperBLAST