PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PfrJS2I to PF01170 (UPF0020)

REBASE::M.PfrJS2I has 561 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.4e-15   41.3   0.0    1.6e-14   40.2   0.0    1.5  1  REBASE::M.PfrJS2I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PfrJS2I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.2   0.0   1.6e-14   1.6e-14      20     148 ..     246     368 ..     240     402 .. 0.85

  Alignments for each domain:
  == domain 1  score: 40.2 bits;  conditional E-value: 1.6e-14
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--.EEEEES-HHHHHHHHHHHHHTT-GG.GEEEEE CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefsq 109
                        +v +   +p++++ DP CG+ ++lI a   +++  p +l        +  + + +++ + + g+D+d+ +++ a  N    g+++ ++++++
  REBASE::M.PfrJS2I 246 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRDHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYRD 329
                        999999*********************999999998665........4445555544446***********************873577777 PP

                        --GGG--STTS---EEEE----------HHHHHHHHHHH CS
            UPF0020 110 adaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                               ++e+++ ++++npP+  +l+ + + ++L + +
  REBASE::M.PfrJS2I 330 SLSEGAANDEDSYSLLLANPPFAGSLDYESTSKDLQQVV 368
                        77777778999****************999999997765 PP



Or compare REBASE::M.PfrJS2I to CDD or PaperBLAST