PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PfrJS9I to PF01170 (UPF0020)

REBASE::M.PfrJS9I has 534 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.3e-14   40.5   0.0    2.2e-14   39.7   0.0    1.4  1  REBASE::M.PfrJS9I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PfrJS9I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.7   0.0   2.2e-14   2.2e-14      20     148 ..     219     341 ..     213     376 .. 0.85

  Alignments for each domain:
  == domain 1  score: 39.7 bits;  conditional E-value: 2.2e-14
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--.EEEEES-HHHHHHHHHHHHHTT-GG.GEEEEE CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefsq 109
                        +v +   +p++++ DP CG+ ++lI a   ++   p +l        +  + + +++ + + g+D+d+ +++ a  N    g+++ ++++++
  REBASE::M.PfrJS9I 219 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRGHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYRD 302
                        999999*********************999998888555........4445555544446***********************873577777 PP

                        --GGG--STTS---EEEE----------HHHHHHHHHHH CS
            UPF0020 110 adaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                                +e+++ ++++npP+  +l+ + + ++L + +
  REBASE::M.PfrJS9I 303 SLSEGAADDEDSYSLVLANPPFAGSLDYESTSKDLQQVV 341
                        77777778999****************999999997765 PP



Or compare REBASE::M.PfrJS9I to CDD or PaperBLAST