PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PinP72I to PF01170 (UPF0020)

REBASE::M.PinP72I has 522 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.8e-13   34.3   0.0    1.9e-12   33.4   0.0    1.4  1  REBASE::M.PinP72I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PinP72I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.4   0.0   1.9e-12   1.9e-12      20     149 ..     190     313 ..     184     365 .. 0.79

  Alignments for each domain:
  == domain 1  score: 33.4 bits;  conditional E-value: 1.9e-12
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE- CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110
                        +v l   kp++++ DP  G+ ++l+ a+   ++  p++lr+       + +++  ++  + g+D+d  +++ +  N    gv++  +++++ 
  REBASE::M.PinP72I 190 MVHLMAPKPEDVICDPAAGTCGFLVAAGEYLRETHPQMLRN-------KDQRAHFHNGMFHGFDFDTTMLRIGAMNMTLHGVDNPnVSYRDS 274
                        9999********************************99854.......33333336666***********************9863778887 PP

                        -GGG--STTS---EEEE----------HHHHHHHHHHHH CS
            UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149
                         a +   +++ + +i++npP+  +l+   + ++L + + 
  REBASE::M.PinP72I 275 LAEEQGSDKEAYSLILANPPFAGSLDYDTTAKDLLKVVK 313
                        77777788889**************99999988877543 PP



Or compare REBASE::M.PinP72I to CDD or PaperBLAST