REBASE::M.PinP72I has 522 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-13 34.5 0.0 1.7e-12 33.6 0.0 1.4 1 REBASE::M.PinP72I Domain annotation for each sequence (and alignments): >> REBASE::M.PinP72I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.6 0.0 1.7e-12 1.7e-12 20 149 .. 190 313 .. 184 365 .. 0.79 Alignments for each domain: == domain 1 score: 33.6 bits; conditional E-value: 1.7e-12 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110 +v l k+++++ DP G+ ++l+ a+ ++ p++lr+ + +++ ++ + g+D+d +++ + N gv++ +++++ REBASE::M.PinP72I 190 MVHLMAPKPEDVICDPAAGTCGFLVAAGEYLRETHPQMLRN-------KDQRAHFHNGMFHGFDFDTTMLRIGAMNMTLHGVDNPnVSYRDS 274 999*********************************99854.......33333336666***********************9853788888 PP UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149 a + +++ + +i++npP+ +l+ + ++L + + REBASE::M.PinP72I 275 LAEEQGSDKEAYSLILANPPFAGSLDYDTTAKDLLKVVK 313 88777788889**************99999988877543 PP
Or compare REBASE::M.PinP72I to CDD or PaperBLAST