PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Ple25539I to PF01170 (UPF0020)

REBASE::M.Ple25539I has 489 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.5e-13   34.9   0.0    1.1e-12   34.1   0.0    1.4  1  REBASE::M.Ple25539I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Ple25539I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.1   0.0   1.1e-12   1.1e-12      19     148 ..     175     296 ..     169     351 .. 0.78

  Alignments for each domain:
  == domain 1  score: 34.1 bits;  conditional E-value: 1.1e-12
                          HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--...EEEEES-HHHHHHHHHHHHHTT-GGG. CS
              UPF0020  19 alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelk...lygsDldrrvvqgareNaekagvgdl. 104
                           +vrl   +p++++ DP CG+ ++lI  a   ++ +            ae+  e+ ++     + g+D dr +++ +  N+    +++  
  REBASE::M.Ple25539I 175 MMVRLLAPTPDDKICDPACGTAGFLISSAEYIREKYE-----------AEMTSEQWDHFAggmFSGFDTDRTMLRLSAMNLMLHSINQPn 253
                          599**************************99999993...........223333333333456*******************99998753 PP

                          EEEEE--GGG--STTS---EEEE----------HHHHHHHHHHH CS
              UPF0020 105 iefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                          i++++   +  +  ++e+d++++npP+   ++++   ++L   +
  REBASE::M.Ple25539I 254 IDYVDSVSK-QNDITSEYDIVLANPPFTGTVDAESIHDNLKTVC 296
                          777774444.4447789**********99998888777776655 PP



Or compare REBASE::M.Ple25539I to CDD or PaperBLAST