PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Psp81I to PF01170 (UPF0020)

REBASE::M.Psp81I has 489 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    2.4e-11   29.8   0.0    4.4e-11   28.9   0.0    1.4  1  REBASE::M.Psp81I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Psp81I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.9   0.0   4.4e-11   4.4e-11      20     145 ..     176     293 ..     170     352 .. 0.74

  Alignments for each domain:
  == domain 1  score: 28.9 bits;  conditional E-value: 4.4e-11
                       HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE-- CS
           UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqad 111
                       +vrl   +p+++++DP CG+ ++l+  a   ++ +   +        + ++ e      + g D dr +++ +  N+    +++  i++++  
  REBASE::M.Psp81I 176 MVRLLAPTPNDKIVDPACGTAGFLVSSAEYIREKYEAEM--------TSVQWEHFSGEMFSGYDTDRTMLRLSAMNLMLHSISQPhIDYVDSV 260
                       99999***********************99999884333........2333333355559******************999987537777766 PP

                       GGG--STTS---EEEE----------HHHHHHHH CS
           UPF0020 112 aakLrlkegevdvivtnpPYGerlgskkalekLY 145
                        ++ +   + +d++++npP+   ++++  +++L 
  REBASE::M.Psp81I 261 SRQNN-VASAYDIVLANPPFTGTVDAESINDNLR 293
                       66555.5668**********99999888887774 PP



Or compare REBASE::M.Psp81I to CDD or PaperBLAST