PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.PspGI to PF01170 (UPF0020)

REBASE::M.PspGI has 433 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------        -----------
    6.2e-13   35.0   0.0    9.5e-10   24.6   0.0    2.4  2  REBASE::M.PspGI  


Domain annotation for each sequence (and alignments):
>> REBASE::M.PspGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.6   0.0   9.5e-10   9.5e-10      21      54 ..      57      89 ..      41     126 .. 0.78
   2 !    8.1   0.0   0.00011   0.00011     111     137 ..     246     273 ..     171     292 .. 0.69

  Alignments for each domain:
  == domain 1  score: 24.6 bits;  conditional E-value: 9.5e-10
                     HHHTT--TTS-EEETT-TTSHHHHHHHHHHTT-- CS
          UPF0020 21 vrlagwkpgepllDPmCGsGtilIEaallgania 54
                     ++l g k+ +++lDP+CGsGt+l+Ea +   n +
  REBASE::M.PspGI 57 IKLWG-KNAKVILDPFCGSGTVLVEAKIKNINSY 89
                     55555.55689***************88777766 PP

  == domain 2  score: 8.1 bits;  conditional E-value: 0.00011
                      -GGG--.STTS---EEEE---------- CS
          UPF0020 111 daakLr.lkegevdvivtnpPYGerlgs 137
                       +  L+ ++ + vd+i+t pPYG++ ++
  REBASE::M.PspGI 246 YHNVLEkADIEGVDLILTSPPYGDSKTT 273
                      344444434447***********98554 PP



Or compare REBASE::M.PspGI to CDD or PaperBLAST