PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Ssp714I to PF01170 (UPF0020)

REBASE::M.Ssp714I has 477 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.5e-15   42.8   0.0    5.2e-15   41.8   0.0    1.5  1  REBASE::M.Ssp714I  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Ssp714I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   41.8   0.0   5.2e-15   5.2e-15      20     148 ..     143     265 ..     137     318 .. 0.83

  Alignments for each domain:
  == domain 1  score: 41.8 bits;  conditional E-value: 5.2e-15
                        HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHH.HH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE CS
            UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeear.aelklygsDldrrvvqgareNaekagvgdl.iefsq 109
                        +v++ +  pg+ + DP CG+G++l+  a  +a+            ++  +e++ + ++  + g+D+d+ +++ +  N    gv++  i +++
  REBASE::M.Ssp714I 143 MVEMMEPSPGDEICDPACGTGGFLVGSAEYVAREHDS--------ALYDVEQRRHfNNSMFHGFDFDSTMLRIGSMNMLLHGVEQPdIRYRD 226
                        99************************99888887743........446666666657777***********************985499999 PP

                        --GGG--STTS---EEEE----------HHHHHHHHHHH CS
            UPF0020 110 adaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                            +  ++++++ +i++npP+  +l+ + + ++L + +
  REBASE::M.Ssp714I 227 SLSESAGEEQDSYSLILANPPFAGSLDYETTSKDLLKVV 265
                        88888889999****************999999987754 PP



Or compare REBASE::M.Ssp714I to CDD or PaperBLAST