PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M.Sth20745II to PF01170 (UPF0020)

REBASE::M.Sth20745II has 507 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.1e-12   34.2   0.0      4e-12   32.4   0.0    1.9  2  REBASE::M.Sth20745II  


Domain annotation for each sequence (and alignments):
>> REBASE::M.Sth20745II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.4   0.0     4e-12     4e-12      18     134 ..     161     274 ..     157     283 .. 0.79
   2 ?   -2.5   0.0      0.18      0.18     148     178 ..     309     339 ..     304     352 .. 0.81

  Alignments for each domain:
  == domain 1  score: 32.4 bits;  conditional E-value: 4e-12
                           HHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHH.HH--EEEEES-HHHHHHHHHHHHHTT-G... CS
               UPF0020  18 aalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeear.aelklygsDldrrvvqgareNaekagvg... 102
                            a+v + + +pge++ DP CG+G++l+ a     +++p l            e++++ +   l+g+++  +v++ +  N+   gvg   
  REBASE::M.Sth20745II 161 QAIVDVMRPQPGETICDPACGTGGFLLAAHNSIVERYPHLD----------PEQRKHlKLHALRGVEIVDSVTRLCAMNLLLHGVGpgp 239
                           69999***********************9999999998444..........333333244449****************9999886322 PP

                           ..GGEEEEE--GGG--.STTS---EEEE------- CS
               UPF0020 103 ..dliefsqadaakLr.lkegevdvivtnpPYGer 134
                               ie  +    +L+ ++++ +dv++tnpP+G++
  REBASE::M.Sth20745II 240 aeADIEPPVRTGDSLNsAPSDHFDVVLTNPPFGRK 274
                           224555555566677777999************86 PP

  == domain 2  score: -2.5 bits;  conditional E-value: 0.18
                           HHHHHHHH-TT..-EEEEEESSHHHHHCC-- CS
               UPF0020 148 flrelkrvlrgggrlvlltsenkalekalee 178
                           f + +k+ l+ +gr+++++++n  +e  ++e
  REBASE::M.Sth20745II 309 FVQHVKSLLKIHGRAAVVVPDNVLFEGGAGE 339
                           7889999999999*****9999998866555 PP



Or compare REBASE::M.Sth20745II to CDD or PaperBLAST