PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M1.EclF77I to PF01170 (UPF0020)

REBASE::M1.EclF77I has 379 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    7.2e-11   28.3   0.0    3.3e-09   22.8   0.0    2.5  2  REBASE::M1.EclF77I  


Domain annotation for each sequence (and alignments):
>> REBASE::M1.EclF77I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.8   0.0   3.3e-09   3.3e-09       6      65 ..      37      99 ..      33     135 .. 0.75
   2 !    2.6   0.0    0.0053    0.0053     107     136 ..     236     265 ..     215     274 .. 0.75

  Alignments for each domain:
  == domain 1  score: 22.8 bits;  conditional E-value: 3.3e-09
                        SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS...H CS
             UPF0020  6 fngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle...l 65
                        + ++++Lk+++A++l+         ++lD ++G Gti+ Ea llg +++   + + +++   +
  REBASE::M1.EclF77I 37 CSYQGKLKPSIARSLIDTFMPSSKGRILDVFSGVGTIPFEARLLGHTAYGFDISPAAVNisrA 99
                        6789*****************************************999944443333335553 PP

  == domain 2  score: 2.6 bits;  conditional E-value: 0.0053
                         EEE--GGG--STTS---EEEE--------- CS
             UPF0020 107 fsqadaakLrlkegevdvivtnpPYGerlg 136
                         f+q   ++ +++ ++ d+i+t pP+ +++ 
  REBASE::M1.EclF77I 236 FYQDSTKSWPEEVNNLDAIITSPPFYDSTR 265
                         4555666677667799*********88875 PP



Or compare REBASE::M1.EclF77I to CDD or PaperBLAST