PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M1.PcoRK1I to PF01170 (UPF0020)

REBASE::M1.PcoRK1I has 494 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    1.4e-15   43.7   0.0    1.4e-14   40.4   0.0    2.2  2  REBASE::M1.PcoRK1I  


Domain annotation for each sequence (and alignments):
>> REBASE::M1.PcoRK1I  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.4   0.0   1.4e-14   1.4e-14       8      56 ..      95     143 ..      92     185 .. 0.82
   2 ?    0.4   0.0     0.025     0.025     111     133 ..     295     319 ..     288     324 .. 0.75

  Alignments for each domain:
  == domain 1  score: 40.4 bits;  conditional E-value: 1.4e-14
                         ---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TT CS
             UPF0020   8 gpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapg 56 
                         ++++ ++++A al+++ +++pg++ lDP+CGsGt lIE + lg +++  
  REBASE::M1.PcoRK1I  95 YKGKFNPQVAKALLNIFKVEPGQTVLDPFCGSGTTLIECCHLGVDAVGT 143
                         57899*************************************9988754 PP

  == domain 2  score: 0.4 bits;  conditional E-value: 0.025
                         -GGG--..STTS---EEEE------ CS
             UPF0020 111 daakLr..lkegevdvivtnpPYGe 133
                         d+ +L+   +  ++d+ +t pPY  
  REBASE::M1.PcoRK1I 295 DVSELTadSAMRKFDAAITSPPYAM 319
                         6777775433449**********76 PP



Or compare REBASE::M1.PcoRK1I to CDD or PaperBLAST