PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M2.BfiI to PF01170 (UPF0020)

REBASE::M2.BfiI has 504 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------        -----------
    8.3e-10   24.8   0.0    2.4e-09   23.3   0.0    1.7  2  REBASE::M2.BfiI  


Domain annotation for each sequence (and alignments):
>> REBASE::M2.BfiI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.3   0.0   2.4e-09   2.4e-09       8      56 ..     101     149 ..      98     187 .. 0.83
   2 ?   -3.4   0.0      0.37      0.37     120     133 ..     316     329 ..     289     331 .. 0.67

  Alignments for each domain:
  == domain 1  score: 23.3 bits;  conditional E-value: 2.4e-09
                      ---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TT CS
          UPF0020   8 gpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapg 56 
                      ++++ ++++  +l+++ ++++++  +DP++GsGt l+E  l+  n++  
  REBASE::M2.BfiI 101 YKGKFNPQVVKSLLNIFNVNENSNVIDPFSGSGTTLLECSLQNINAIGL 149
                      5688899999********************************9999844 PP

  == domain 2  score: -3.4 bits;  conditional E-value: 0.37
                      S---EEEE------ CS
          UPF0020 120 gevdvivtnpPYGe 133
                      + +d+ +t pPY  
  REBASE::M2.BfiI 316 NYFDAGITSPPYAT 329
                      36788899999975 PP



Or compare REBASE::M2.BfiI to CDD or PaperBLAST