REBASE::M2.BfiI has 504 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-10 25.1 0.0 1.9e-09 23.6 0.0 1.7 2 REBASE::M2.BfiI Domain annotation for each sequence (and alignments): >> REBASE::M2.BfiI # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.6 0.0 1.9e-09 1.9e-09 8 56 .. 101 149 .. 98 187 .. 0.83 2 ? -3.4 0.0 0.36 0.36 120 133 .. 316 329 .. 288 331 .. 0.67 Alignments for each domain: == domain 1 score: 23.6 bits; conditional E-value: 1.9e-09 UPF0020 8 gpapLketLAaalvrlagwkdgepllDPmCGsGtilIEaallganiapg 56 ++++ ++++ +l+++ ++++++ +DP++GsGt l+E l+ n++ REBASE::M2.BfiI 101 YKGKFNPQVVKSLLNIFNVNENSNVIDPFSGSGTTLLECSLQNINAIGL 149 5688899999********************************9999844 PP == domain 2 score: -3.4 bits; conditional E-value: 0.36 UPF0020 120 gevdvivtnpPYGe 133 + +d+ +t pPY REBASE::M2.BfiI 316 NYFDAGITSPPYAT 329 36788899999975 PP
Or compare REBASE::M2.BfiI to CDD or PaperBLAST